Welcome to ClientVPS Mirrors

Getting Started with ggrecipes

Getting Started with ggrecipes

This vignette provides a quick visual overview of available functions. Use the sidebar to jump to sections of interest. For complete parameter lists and the many available customization options, refer to the individual function documentation (?function_name).

library(ggrecipes)

General

Split-Correlation Heatmap

Standard correlation heatmaps are symmetric, displaying identical information in both triangles. When comparing two groups, gg_splitcorr() uses this redundancy by displaying one group’s correlations in the upper triangle and the other group’s in the lower triangle. The function requires a data frame with numeric variables and a binary splitting variable. It computes pairwise correlations for each group, adjusts p-values for multiple testing within each, and labels only statistically significant correlations with their values.

# Compare correlations between V-shaped vs straight engines
gg_splitcorr(
  data = mtcars,
  split = "vs",
  prefix = "Engine Type: "
)

Currently there are two styles to choose from, tile (default) and point.

# Alternative style
gg_splitcorr(
  data = mtcars,
  split = "vs",
  prefix = "Engine Type: ",
  style = "point"
)

See ?gg_splitcorr for correlation methods, p-value adjustment options, color schemes, and style customization.

Rank Shift Plots

A frequently encountered task is assessing how the ranking of a set of samples changes across two conditions. gg_rankshift() creates a three-panel visualization: side panels display ranked distributions for each condition, while the center panel connects corresponding samples with lines colored by rank change direction. The function requires data with sample identifiers, a grouping variable containing exactly two levels, and a numeric value for ranking. Ranks are calculated using summary statistics (mean or median) controlled by stat_summary.

# Synthetic data - bacterial strain growth rates
growth_data <- data.frame(
  strain = rep(paste0("Strain", 1:13), each = 6),
  condition = rep(c("Control", "Treated"), each = 3, times = 13),
  growth_rate = c(
    rnorm(39, mean = 0.85, sd = 0.12),  # Control
    rnorm(39, mean = 0.45, sd = 0.10)   # Treated
  )
)

gg_rankshift(
  data = growth_data,
  id = "strain",
  group = "condition",
  value = "growth_rate"
)

# Alternative style & minor customizations
gg_rankshift(
  data = growth_data,
  id = "strain",
  group = "condition",
  value = "growth_rate",
  style = "bar",
  fill = c("#e41a1c", "#377eb8"),
  rank_change_colors = c(
    increase = "#1b9e77",
    decrease = "#d95f02",
    no_change = "#7570b3"
  ),
  panel_ratio = 0.65,
  point_size = 2.5,
  line_width = 1,
  decreasing = TRUE
)

See ?gg_rankshift for options to customize colors, adjust panel widths, and control point display.

Confusion/Contingency Tables

gg_conf() creates bubble plots where bubble size represents frequency counts for each unique combination of two categorical variables. The function automatically computes these counts from the raw data using table(). Results can also be facetted when additional categorical variables are supplied.

data(mtcars)
mtcars$horsepower <- 
  cut(mtcars$hp, breaks = 5, 
         labels = c("Very Low", "Low", "Medium", "High", "Very High"))
mtcars$`miles per gallon` <- 
  cut(mtcars$mpg, breaks = 5,
         labels = c("Very Low", "Low", "Medium", "High", "Very High"))

gg_conf(data = mtcars, x = "horsepower", y = "miles per gallon")

# Custom styling
gg_conf(data = mtcars, x = "horsepower", y = "miles per gallon",
        fill = "lightcoral", point_size_range = c(5, 20),
        show_grid = FALSE)

# With faceting by "vs" column
gg_conf(data = mtcars, x = "horsepower", y = "miles per gallon",
        fill = "lightcoral", point_size_range = c(5, 20),
        facet_x = "vs")

See ?gg_conf for customization of colors, sizes, grid display, and faceting options.

Criteria Heatmaps

gg_criteria() displays samples against multiple criteria as a heatmap. Optional barplots can be added to show continuous metrics. As the vertical alignment between heatmap and barplot panels depends on the exported figure dimensions, the function provides recommended sizes based on the number of candidates and criteria.

# Create example data
# Example: Gene prioritization criteria
gene_data <- data.frame(
  gene = c("BRCA1", "TP53", "EGFR", "KRAS", "MYC", 
           "PTEN", "APC", "CDKN2A", "RB1", "VHL"),
  `Missense Variant_crit` = c("Yes", "Yes", "Yes", NA, "Yes", 
                               "Yes", NA, "Yes", NA, "Yes"),
  `eQTL_crit` = c("Yes", "Yes", NA, "Yes", "Yes", 
                  "Yes", "Yes", "Yes", "Yes", NA),
  `pQTL_crit` = c("Yes", NA, "Yes", "Yes", NA, 
                  "Yes", "Yes", NA, "Yes", "Yes"),
  `GWAS Hit_crit` = c("Yes", "Yes", "Yes", "Yes", NA, 
                      "Yes", "Yes", "Yes", NA, NA),
  `Loss of Function_crit` = c(NA, "Yes", NA, NA, "Yes", 
                              "Yes", "Yes", NA, "Yes", NA),
  `High Conservation_crit` = c("Yes", "Yes", "Yes", "Yes", "Yes", 
                               "Yes", "Yes", "Yes", "Yes", "Yes"),
  `mRNA DE_crit` = c("Yes", NA, "Yes", NA, NA,
                     "Yes", "Yes", "Yes", NA, "Yes"),
  `Prot DE_crit` = c(NA, "Yes", NA, NA, NA,
                     "Yes", NA, NA, NA, "Yes"),
  check.names = FALSE
)

# Calculate total criteria met
crit_cols <- grep("_crit$", names(gene_data), value = TRUE)
gene_data$`Total` <- rowSums(gene_data[crit_cols] == "Yes", na.rm = TRUE)

head(gene_data)
#>    gene Missense Variant_crit eQTL_crit pQTL_crit GWAS Hit_crit
#> 1 BRCA1                   Yes       Yes       Yes           Yes
#> 2  TP53                   Yes       Yes      <NA>           Yes
#> 3  EGFR                   Yes      <NA>       Yes           Yes
#> 4  KRAS                  <NA>       Yes       Yes           Yes
#> 5   MYC                   Yes       Yes      <NA>          <NA>
#> 6  PTEN                   Yes       Yes       Yes           Yes
#>   Loss of Function_crit High Conservation_crit mRNA DE_crit Prot DE_crit Total
#> 1                  <NA>                    Yes          Yes         <NA>     6
#> 2                   Yes                    Yes         <NA>          Yes     6
#> 3                  <NA>                    Yes          Yes         <NA>     5
#> 4                  <NA>                    Yes         <NA>         <NA>     4
#> 5                   Yes                    Yes         <NA>         <NA>     4
#> 6                   Yes                    Yes          Yes          Yes     8
# Base criteria plot
gg_criteria(
  data = gene_data,
  id = "gene",
  criteria = "_crit$",
  show_text = FALSE
)
#> Recommended dimensions: 5.2 x 5.5 inches

# With added barplot
gg_criteria(
  data = gene_data,
  id = "gene",
  criteria = "_crit$",
  bar_column = "Total",
  show_text = FALSE,
  tile_fill = c(Yes = "#A6CEE3", No = "white"),
  bar_fill = "#A6CEE3",
  panel_ratio = 0.7
)
#> Recommended dimensions: 7.2 x 5.5 inches

Criterion values can be displayed as text labels on tiles.

# Example: VHH Variant Analysis
# Define amino acid chemistry colors
aa_colors <- c(
  "D" = "#E60A0A", "E" = "#E60A0A", # Acidic (red)
  "K" = "#145AFF", "R" = "#145AFF", # Basic (blue)
  "H" = "#8282D2",                  # Histidine (purple)
  "S" = "#FA9600", "T" = "#FA9600", # Polar uncharged (orange)
  "N" = "#00DCDC", "Q" = "#00DCDC", # Polar amides (cyan)
  "C" = "#E6E600",                  # Cysteine (yellow)
  "G" = "#EBEBEB",                  # Glycine (light gray)
  "P" = "#DC9682",                  # Proline (tan)
  "A" = "#C8C8C8",                  # Alanine (gray)
  "V" = "#0F820F", "I" = "#0F820F", # Hydrophobic (green)
  "L" = "#0F820F", "M" = "#0F820F",
  "F" = "#3232AA", "W" = "#B45AB4", # Aromatic (dark blue/purple)
  "Y" = "#3232AA"
)

vhh_variants <- data.frame(
  variant = c("WT", "Mut1", "Mut2", "Mut3", "Mut4", "Mut7", "Mut5",
              "Mut6", "Mut8", "Mut9", "Mut10", "Mut11"),
  Q5_mut = c(NA, "H", NA, NA, NA, NA, "H", "H", "H", "D", NA, "H"),
  S55_mut = c(NA, NA, "P", NA, NA, "P", "P", NA, "P", "P", NA, NA),
  N73_mut = c(NA, NA, NA, "E", NA, NA, NA, "E", "E", NA, "E", NA),
  K80_mut = c(NA, "L", NA, NA, "S", "V", NA, NA, NA, "L", "S", NA),
  F99_mut = c(NA, NA, "L", NA, NA, NA, NA, NA, NA, "W", NA, "W"),
  KD_nM = c(45, 18, 5.2, 38, 42, 20, 3.8, 15, 3.2, 4.5, 40, 22),
  yield_mg_L = c(12, 11.8, 10, 13, 11, 10, 10, 12, 10, 7.8, 12.5, 8.5),
  Tm_C = c(68.5, 67.8, 68, 72.3, 35, 66, 67.5, 70, 70.5, 72, 38, 74)
)
# Create plot
gg_criteria(
  data = vhh_variants,
  id = "variant",
  criteria = "_mut$",
  tile_fill = aa_colors,
  bar_column = c("KD_nM", "yield_mg_L", "Tm_C"),
  panel_ratio = 2,
  tile_width = 0.70,
  tile_height = 0.70,
  show_text = TRUE,
  border_color = "grey40",
  border_width = 0.4,
  text_size = 10,
  show_legend = FALSE
)
#> Recommended dimensions: 10.0 x 5.9 inches

See ?gg_criteria for tile customization, border styling, and multi-barplot options.

Bioinformatics

Genotype Heatmaps

Genotype data typically consist of biallelic markers such as SNPs, where each individual carries two alleles at each locus. gg_geno() provides a specialized visualization for these data, sharing the core design and features of gg_criteria() but adapted for diploid genotypes. Each tile is split diagonally to represent both alleles simultaneously, with samples occupying rows and genetic markers occupying columns.

The function accepts data in wide format with genotype columns identified by a regular expression pattern. Genotypes must be encoded as “allele1/allele2” for unphased data or “allele1|allele2” for phased data. The function automatically detects phasing based on the separator and visually distinguishes the two cases using border colors: black borders indicate phased genotypes, while white borders indicate unphased genotypes. The top-left triangle displays the first allele, and the bottom-right triangle displays the second allele.

Like gg_criteria(), the function supports horizontal barplots via bar_column to display continuous variables alongside genotypes.

# Create example SNP and phenotype data
set.seed(123)

snp_data <- data.frame(
  id = paste0("P", sprintf("%03d", 1:12)),
  # SNP columns
  rs1234_geno = sample(c(c("0/0", "0/1", "1/1"), NA),
                       12, replace = TRUE, 
                       prob = c(0.4, 0.4, 0.15, 0.05)),
  rs5678_geno = sample(c("0/0", "0/1", "0/2", "1/1", "1/2", "2/2", NA),
                       12, replace = TRUE, 
                       prob = c(0.25, 0.25, 0.1, 0.15, 0.15, 0.05, 0.05)),
  rs9012_geno = sample(c(c("0|0", "0|1", "1|1", "0/1", "1/2"), NA),
                       12, replace = TRUE,  
                       prob = c(0.2, 0.2, 0.15, 0.2, 0.15, 0.1)),
  rs3456_geno = sample(c(c("0/0", "0/1", "1/1"), NA),
                       12, replace = TRUE,  
                       prob = c(0.45, 0.35, 0.15, 0.05)),
  rs7890_geno = sample(c("0/0", "0/1", "0/2", "1/3", "2/2", NA),
                       12, replace = TRUE,  
                       prob = c(0.3, 0.25, 0.15, 0.1, 0.15, 0.05)),
  rs2468_geno = sample(c("0|0", "0|1", "1|1", "1|2", NA),
                       12, replace = TRUE, 
                       prob = c(0.3, 0.35, 0.2, 0.1, 0.05)),
  
  # Phenotype columns for bar plots
  Age = sample(25:75, 12, replace = TRUE),
  BMI = round(rnorm(12, mean = 26, sd = 4), 1),
  Insulin = round(rnorm(12, mean = 12, sd = 3), 1)
)

head(snp_data)
#>     id rs1234_geno rs5678_geno rs9012_geno rs3456_geno rs7890_geno rs2468_geno
#> 1 P001         0/0         1/2         1|1         0/1         0/0         1|1
#> 2 P002         0/1         1/1         1|1         0/0         1/3         0|1
#> 3 P003         0/1         0/1         0/1         0/0         0/0         0|0
#> 4 P004         1/1         0/2         0/1         0/0         0/1         0|1
#> 5 P005         1/1         0/1         0|1         0/0         2/2         1|1
#> 6 P006         0/0         0/1         0|0         0/0         0/0         0|0
#>   Age  BMI Insulin
#> 1  39 34.7    16.5
#> 2  65 30.8     7.4
#> 3  71 21.5    13.8
#> 4  50 24.4    12.4
#> 5  55 24.1    12.6
#> 6  40 29.1    13.1
# Base genotype plot
gg_geno(
  data = snp_data,
  id = "id",
  geno = "_geno$"
)
#> Recommended dimensions: 4.4 x 6.3 inches

# Show optional barplots
gg_geno(
  data = snp_data,
  id = "id",
  geno = "_geno$",
  show_legend = TRUE,
  panel_ratio = 1,
  bar_column = c("Age", "BMI", "Insulin"),
  bar_fill = c("#c77d77", "#e0b46e", "#c7bc77"),
  text_size = 10
)
#> Recommended dimensions: 10.4 x 6.3 inches

See ?gg_geno for allele color customization, tile sizing, and barplot styling.

Sequence Coverage

gg_seq() displays substrings of a reference sequence, with each unique sequence shown as a row at its aligned position. Useful for visualizing peptide mapping coverage, or any analysis where you need to show which parts of a reference sequence are covered by shorter sequences. Supports character coloring and region highlighting (e.g. tags, binding sites, CDRs).

# Create synthetic example of peptide mapping data
# Reference sequence
ref_seq <- paste0(
  "QVQLVESGGGLVQAGGSLRLSCAASGFTFSSYAMGWFRQAPGKEREFVAAINSGGST",
  "YYPDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLRGTTVNNYWGQGTQV",
  "TVSSEQKLISEEDL"
)

# Peptides with RT and intensity
df_peptides <- data.frame(
  id = c("Pep_1004", "Pep_1010", "Pep_1007", "Pep_1011", 
         "Pep_1009", "Pep_1005", "Pep_1013", "Pep_1003", 
         "Pep_1001", "Pep_1012", "Pep_1006", "Pep_1008", 
         "Pep_1002"),
  sequence = c(
    "QAPGKER",
    "GRFTISR",
    "GTTVNNYWGQGTQVTVSSEQKLISEEDL",
    "GRFTISRDNAKNTVYLQMNSLK",
    "EREFVAAINSGGSTYYPDSVK",
    "QAPGKEREFVAAINSGGSTYYPDSVKGR",
    "NTVYLQMNSLKPEDTAVYYCAADLR",
    "LSCAASGFTFSSYAMGWFRQAPGKER",
    "QVQLVESGGGLVQAGGSLR",
    "PEDTAVYYCAADLRGTTVNNYWGQGTQVTVSSEQKLISEEDL",
    "FTISRDNAKNTVYLQMNSLKPEDTAVYYCAADLR",
    "LSCAASGFTFSSYAMGWFRQAPGK",
    "LSCAASGFTFSSYAMGWFR"
  ),
  rt_min = c(10, 28.5, 34.4, 34.4, 36, 36.5, 40.8, 
             42.5, 42.8, 43.3, 44.1, 44.8, 46.7),
  intensity = c(2769840, 2248170, 2172370, 1698280, 2202810, 
                983267, 659246, 1064906, 1988932, 1438544, 
                639990, 1017811, 1112824),
  stringsAsFactors = FALSE
)

head(df_peptides)
#>         id                     sequence rt_min intensity
#> 1 Pep_1004                      QAPGKER   10.0   2769840
#> 2 Pep_1010                      GRFTISR   28.5   2248170
#> 3 Pep_1007 GTTVNNYWGQGTQVTVSSEQKLISEEDL   34.4   2172370
#> 4 Pep_1011       GRFTISRDNAKNTVYLQMNSLK   34.4   1698280
#> 5 Pep_1009        EREFVAAINSGGSTYYPDSVK   36.0   2202810
#> 6 Pep_1005 QAPGKEREFVAAINSGGSTYYPDSVKGR   36.5    983267
# Base coverage map
gg_seq(data = df_peptides, ref = ref_seq, wrap = 70)

# With peptide IDs and residue coloring
gg_seq(
  data = df_peptides, 
  ref = ref_seq, 
  name = "id",
  color = c(C = "red", K = "blue", R = "#468c2d"), 
  highlight = list(
    "#ffb4b4" = c(27:33, 51:57, 96:107),
    "#70bcfa" = c(1, 43, 64, 75, 86)
  ),
  wrap = 70
)

# With annotations
gg_seq(
  data = df_peptides, 
  ref = ref_seq, 
  name = "id",
  color = c(C = "red", K = "blue", R = "#468c2d"),
  highlight = list(
    "#ffb4b4" = c(27:33, 51:57, 96:107),  # CDR regions
    "#70bcfa" = c(1, 43, 64, 75, 86),     # Lysines
    "#d68718" = c(105:106),               # Liability site
    "#94d104" = c(119:128)                # c-Myc tag
  ),
  annotate = list(
    list(label = "CDR1", pos = 30),
    list(label = "CDR2", pos = 54),
    list(label = "CDR3", pos = 101),
    list(label = "N-term", pos = 1, angle = 90, vjust = 1),
    list(label = "K43", pos = 43, angle = 90),
    list(label = "K64", pos = 64, angle = 90),
    list(label = "K75", pos = 75, angle = 90),
    list(label = "K86", pos = 86, angle = 90),
    list(label = "Liability", pos = 106, angle = 90),
    list(label = "c-Myc tag", pos = 124)
  ),
  annotate_defaults = list(face = "bold"),
  wrap = 80
)

See ?gg_seq for residue coloring, region highlighting, annotation options, and wrapping control.

Sequence Differences

For sequence variant analysis, a common approach is displaying only substituted positions to reduce visual noise (e.g., Jalview’s “Show Differences from Reference” option or MSA viewers with consensus masking). gg_seqdiff() displays only positions that differ from the reference, with matching positions hidden. Only substituted characters are displayed, making mutations immediately visible. The function can also parse Clustal alignment files directly using the clustal argument. gg_seqdiff() supports the same customization options as gg_seq().

# -----------------------------------------------------------------------
# Example with Clustal alignment file
# -----------------------------------------------------------------------
# Create a temporary Clustal file
clustal_file <- tempfile(fileext = ".aln")
writeLines(c(
  "CLUSTAL W (1.83) multiple sequence alignment",
  "",
  "WT              EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP",
  "Mutant1         EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP",
  "Mutant2         EQKLISEEDLMKTAYIAKQRQRSFVKSHFSRQLERIEKKWEAHFDDLHP",
  "Mutant3         EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLER----IEAHFDDLHP",
  "Mutant4         EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQAERIEKKIEAHFDDLHP",
  "Mutant5         EQKLISEEDLAKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDRHP",
  "Mutant6         EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP",
  "                *********** ***************** * ******* *******:**",
  "",
  "WT              DIVALSGHTFGKTHGAGKQSSHHHHHH",
  "Mutant1         DIVALSGHTFGKTHGAGKQSSHHHHHH",
  "Mutant2         DIVALSGHTFGKTHGAGKQSSHHHHHH",
  "Mutant3         DIVALSGHTFGKTHGAGKQSS------",
  "Mutant4         DIVALSGHTFGKTHGAGKQSSHHHHHH",
  "Mutant5         DIVALSGHTFGKTHGAGKQSSHHHHHH",
  "Mutant6         DRVALSGHTFAKTHGAGKQSS------",
  "                * ******** **********      "
), clustal_file)

# Plot Clustal alignment
gg_seqdiff(
  clustal = clustal_file,
  ref = paste0("EQKLISEEDLMKTAYIAKQRQISFVKSHFSRQLERIEKKIEAHFDDLHP",
               "DIVALSGHTFGKTHGAGKQSSHHHHHH"),
  color = c(K = "#285bb8", R = "#285bb8",    # Basic
            E = "#a12b20", D = "#a12b20",    # Acidic
            W = "#9b59b6", F = "#9b59b6",    # Aromatic
            H = "#f39c12"),                  # Histidine
  highlight = list(
    "#94d104" = 1:10,      # N-terminal c-Myc tag
    "#FFE0B2" = 30:45,     # Active site
    "#94d104" = 72:77      # C-terminal His-tag
  ),
  annotate = list(
    list(label = "c-Myc", pos = 5),
    list(label = "Active site", pos = 37),
    list(label = "6xHis", pos = 74)
  ),
  wrap = 60
)

# Clean up
unlink(clustal_file)

# -----------------------------------------------------------------------
# Example with DNA sequences - gene structure with regulatory elements
# -----------------------------------------------------------------------
dna_ref <- paste0(
  "TATAAA",                       # TATA box (promoter)
  "ATGCGATCGATCGATCGTAGCTAGCT",   # Exon 1
  "GTAAGTATCGATCGAT",             # Intron 1 (splice sites: GT...AG)
  "ACGTACGTACGTAGCTAGCTAGCTAC",   # Exon 2
  "GTACGTACGTACGTAC",             # Intron 2
  "GTACGTACGTAGCTAGCTAGCTACGT",   # Exon 3
  "ACGTACGTAAATAA"                # 3'UTR with poly-A signal
)

dna_df <- data.frame(
  sequence = c(
    dna_ref,                         
    sub("TATAAA", "TATATA", dna_ref),
    gsub("GTAAGT", "ATAAGT", dna_ref),
    gsub("CGATAG", "CGATAA", dna_ref),
    sub("ATG", "AAG", dna_ref),
    gsub("AATAA$", "AACAA", dna_ref),
    sub("GCGATCGATCGATCG", "GCGATCAATCGATCG", dna_ref),
    gsub("ACGTACGTACGTAG", "ACGTACATACGTAG", dna_ref)
  ),
  id = c("WT", "Promoter_mut", "Splice_donor",
         "Splice_acceptor", "Start_codon", "PolyA_mut",
         "Exon1_missense", "Exon2_frameshift")
)

# Highlight gene structure elements
gg_seqdiff(
  data = dna_df, 
  ref = dna_ref, 
  name = "id",
  color = c(G = "#4e8fb5", C = "#845cab"),
  highlight = list(
    "#FFE0B2" = 1:6,                     # TATA box (promoter)
    "#C8E6C9" = c(7:32, 49:74, 91:116),  # Exons
    "#FFCCBC" = 117:130                  # 3'UTR with poly-A
  ),
  annotate = list(
    list(label = "TATA", pos = 1, angle = 90),
    list(label = "ATG", pos = 7, angle = 90, color = "red"),
    list(label = "Exon1", pos = 19),
    list(label = "GT", pos = 33, angle = 90, size = 2.5),
    list(label = "GA", pos = 46, angle = 90, size = 2.5),
    list(label = "Exon2", pos = 61),
    list(label = "GT", pos = 75, angle = 90, size = 2.5),
    list(label = "AC", pos = 89, angle = 90, size = 2.5),
    list(label = "Exon3", pos = 103),
    list(label = "AATAAA", pos = 125, angle = 90, color = "blue")
  ),
  wrap = 80
)

See ?gg_seqdiff for Clustal file support, residue coloring, and annotation options.

Biodistribution Plots

gg_biodist() creates a barplot visualization of biodistribution data (e.g., %ID/g across organs) with optional separation of specific organs onto free y-scales to prevent squishing of lower values. Points are overlaid on bars and all facets are displayed in a single row.

bio_data <- data.frame(
  id        = paste0("sample_", 1:6),
  condition = rep(c("Control", "Treated"), each = 3),
  replicate = rep(1:3, times = 2),

  Blood_val  = c(4.8, 5.2, 4.5, 4.1, 4.3, 4.0),
  Heart_val  = c(1.9, 2.1, 2.0, 1.6, 1.8, 1.7),
  Lung_val   = c(3.5, 3.8, 3.2, 3.0, 3.1, 2.9),
  Liver_val  = c(14.2, 15.1, 13.8, 11.5, 12.0, 11.2),
  Spleen_val = c(9.1, 8.7, 9.4, 7.2, 7.5, 7.0),
  Kidney_val = c(125.0, 112.8, 121.9, 111.1, 102.4, 103.0),
  Tumor_val  = c(22.5, 24.1, 23.3, 28.2, 29.5, 27.8),
  Muscle_val = c(0.7, 0.6, 0.8, 0.5, 0.4, 0.6),
  Bone_val   = c(1.4, 1.6, 1.5, 1.1, 1.2, 1.0)
)

head(bio_data)
#>         id condition replicate Blood_val Heart_val Lung_val Liver_val
#> 1 sample_1   Control         1       4.8       1.9      3.5      14.2
#> 2 sample_2   Control         2       5.2       2.1      3.8      15.1
#> 3 sample_3   Control         3       4.5       2.0      3.2      13.8
#> 4 sample_4   Treated         1       4.1       1.6      3.0      11.5
#> 5 sample_5   Treated         2       4.3       1.8      3.1      12.0
#> 6 sample_6   Treated         3       4.0       1.7      2.9      11.2
#>   Spleen_val Kidney_val Tumor_val Muscle_val Bone_val
#> 1        9.1      125.0      22.5        0.7      1.4
#> 2        8.7      112.8      24.1        0.6      1.6
#> 3        9.4      121.9      23.3        0.8      1.5
#> 4        7.2      111.1      28.2        0.5      1.1
#> 5        7.5      102.4      29.5        0.4      1.2
#> 6        7.0      103.0      27.8        0.6      1.0
# Base biodist plot
gg_biodist(bio_data, id = "organ",
           value = "_val", group = "condition",
           point_size = 1.25,
           y_label = "%ID/g")

# Separate high uptake organs on separate axis
gg_biodist(bio_data, id = "organ",
           value = "_val", group = "condition",
           point_size = 1.25,
           y_label = "%ID/g",
           separate = c("Tumor", "Kidney"))

# Customization
gg_biodist(bio_data, id = "organ",
           value = "_val", group = "condition",
           point_size = 0, error_bars = TRUE,
           fill_colors = c("#e41a1c", "#377eb8"),
           y_label = "%ID/g",
           separate = c("Tumor", "Kidney"))

See ?gg_biodist for error bar options, summary statistic choices, and color customization.

Chemoinformatics

Kinetic Rate Maps

Kinetic binding data from assays such as surface plasmon resonance (SPR) or biolayer interferometry (BLI) are often summarized as association (ka) and dissociation (kd) rate constants. gg_kdmap() displays these measurements on a log-log plot with kd on the x-axis and ka on the y-axis. Diagonal iso-affinity contours indicate constant equilibrium dissociation constants (KD = kd/ka), so points along the same line share the same affinity. The function requires a data frame with columns for association rate (ka, in M⁻¹s⁻¹), dissociation rate (kd, in s⁻¹), and an identifier for grouping replicates.

# Basic example: 5 variants with single measurements
kinetic_data <- data.frame(
  id = c("WT", "Mut1", "Mut2", "Mut3", "Mut4"),
  ka = c(1.2e5, 2.5e5, 2e5, 8.0e4, 1.8e5),
  kd = c(1.5e-3, 2.0e-3, 1.5e-3, 1.2e-3, 1.8e-3)
)

gg_kdmap(data = kinetic_data, show_anno = TRUE)
#> `geom_line()`: Each group consists of only one observation.
#> ℹ Do you need to adjust the group aesthetic?

# With replicates: lines connect points with same ID
kinetic_rep <- data.frame(
  id = c("WT", "WT", "WT", "Mut1", "Mut1", "Mut2", "Mut3", "Mut4"),
  ka = c(1.2e5, 1.5e5, 1.1e5, 2.5e5, 2.4e5, 2e5, 8.0e4, 1.8e5),
  kd = c(1.5e-3, 1.6e-3, 1.4e-3, 2.0e-3, 1.9e-3, 1.5e-3, 1.2e-3, 1.8e-3)
)

head(kinetic_rep)
#>     id     ka     kd
#> 1   WT 120000 0.0015
#> 2   WT 150000 0.0016
#> 3   WT 110000 0.0014
#> 4 Mut1 250000 0.0020
#> 5 Mut1 240000 0.0019
#> 6 Mut2 200000 0.0015

gg_kdmap(data = kinetic_rep, show_anno = TRUE, fill = "id")


# Add labels and highlight reference
gg_kdmap(data = kinetic_rep, show_anno = TRUE, fill = "id")


# Customize iso-KD lines
gg_kdmap(data = kinetic_rep, show_anno = TRUE, fill = "id")

See ?gg_kdmap for replicate line options, reference highlighting, label placement, and iso-KD line customization.

Further Customization

All functions return ggplot2 objects that can be further modified using standard ggplot2 syntax (see ggplot2::ggplot() and related documentation). Below is a brief illustration using one of the functions; the same approach applies to all other functions in this package.

library(ggplot2)
p <- gg_splitcorr(data = mtcars, split = "vs")

# Adjust legend
p + theme(legend.position = "bottom")

# Theme adjustments
p + theme(axis.text.x = element_text(angle = 90))

# Labels
p + labs(title = "Correlation comparison", 
         caption = "Data: mtcars") +
  theme(plot.title = element_text(vjust = 3))

# Coordinate transformations
p + coord_fixed(ratio = 1.5)
#> Coordinate system already present.
#> ℹ Adding new coordinate system, which will replace the existing one.

# Font adjustments
p + theme(text = element_text(family = "serif", size = 14))

Need a high-speed mirror for your open-source project?
Contact our mirror admin team at info@clientvps.com.

This archive is provided as a free public service to the community.
Proudly supported by infrastructure from VPSPulse , RxServers , BuyNumber , UnitVPS , OffshoreName and secure payment technology by ArionPay.